SCOPe 2.08: Domain d1oahb_: 1oah B:

Lineage for d1oahb_ (1oah B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein Cytochrome c nitrite reductase [48718] (5 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [89173] (1 PDB entry)

8. Domain d1oahb_: 1oah B: [86737]
   complexed with ca, cl, hec, zn

Details for d1oahb_

PDB Entry: 1oah, 2.3 Å

PDB Description: cytochrome c nitrite reductase from desulfovibrio desulfuricans atcc 27774: the relevance of the two calcium sites in the structure of the catalytic subunit (nrfa).

PDB Compounds: (B:) cytochrome c nitrite reductase

SCOPe Domain Sequences for d1oahb_:

Sequence; same for both SEQRES and ATOM records:

>d1oahb_ a.138.1.3 (B:) Cytochrome c nitrite reductase {Desulfovibrio desulfuricans [TaxId: 876]}
tgiaetetkmsafkgqfpqqyasymknnedrimtdykgsvpyhkndnvnplpkgfkhaqp
ylknlwlgypfmyeynetrghtyaiddflnidrinrfaadgkgnlpatcwncktpkmmew
vsqygdkfwsmdvnefrakdkinahdetigcanchdpatmelrlyseplkdwlkrsgkdw
qkmsrnekrtlvcaqchveyyfthkdngpaakpvfpwdngfnpedmyqyykghgakgpdg
kpgpfvdwvhaaskvpmikmqhpeyetfqdgphgaagvscadchmqyvredgkkisshwm
tspmkdpemracrqchadktgeylrqrvlytqqktfdqllkaqemsvkaheavrlanaye
ghraanyealmaearemvrkgqlfwdyvsaensvgfhnpakaldtlmtsmecsqkavdla
teatdfgiapalagdikklvppiltlsrklqqdpeflkqnpwtrllpalpkaeqvwegqd
ra

Timeline for d1oahb_:

• d1oahb_ first appeared in SCOP 1.65
  
• d1oahb_ appears in SCOPe 2.07