Lineage for d1oaga_ (1oag A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2719959Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2719960Protein Ascorbate peroxidase [48123] (3 species)
  7. 2719966Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries)
    Uniprot Q43758
  8. 2719975Domain d1oaga_: 1oag A: [86735]
    complexed with hem, so4

Details for d1oaga_

PDB Entry: 1oag (more details), 1.75 Å

PDB Description: ascorbate peroxidase from soybean cytosol
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d1oaga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaga_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

SCOPe Domain Coordinates for d1oaga_:

Click to download the PDB-style file with coordinates for d1oaga_.
(The format of our PDB-style files is described here.)

Timeline for d1oaga_: