Lineage for d1oafa1 (1oaf A:2-250)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333060Protein Ascorbate peroxidase [48123] (3 species)
  7. 2333066Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries)
    Uniprot Q43758
  8. 2333067Domain d1oafa1: 1oaf A:2-250 [86734]
    Other proteins in same PDB: d1oafa2
    complexed with asc, hem, na

Details for d1oafa1

PDB Entry: 1oaf (more details), 1.4 Å

PDB Description: ascobate peroxidase from soybean cytosol in complex with ascorbate
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d1oafa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oafa1 a.93.1.1 (A:2-250) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

SCOPe Domain Coordinates for d1oafa1:

Click to download the PDB-style file with coordinates for d1oafa1.
(The format of our PDB-style files is described here.)

Timeline for d1oafa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oafa2