Class a: All alpha proteins [46456] (286 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein Ascorbate peroxidase [48123] (3 species) |
Species Soybean (Glycine max) [TaxId:3847] [89092] (9 PDB entries) Uniprot Q43758 |
Domain d1oafa_: 1oaf A: [86734] complexed with asc, hem, na |
PDB Entry: 1oaf (more details), 1.4 Å
SCOPe Domain Sequences for d1oafa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgti khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq klselgfada
Timeline for d1oafa_: