SCOP 1.73: Domain d1oafa_: 1oaf A:

Lineage for d1oafa_ (1oaf A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Ascorbate peroxidase [48123] (3 species)

7. Species Soybean (Glycine max) [TaxId:3847] [89092] (5 PDB entries)

8. Domain d1oafa_: 1oaf A: [86734]
   complexed with asc, hem, na

Details for d1oafa_

PDB Entry: 1oaf, 1.4 Å

PDB Description: ascobate peroxidase from soybean cytosol in complex with ascorbate

PDB Compounds: (A:) ascorbate peroxidase

SCOP Domain Sequences for d1oafa_:

Sequence; same for both SEQRES and ATOM records:

>d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgti
khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
klselgfada

Timeline for d1oafa_:

• d1oafa_ first appeared in SCOP 1.65
  
• d1oafa_ appears in SCOP 1.71
  
• d1oafa_ appears in SCOP 1.75
  
• d1oafa_ appears in the current release, SCOPe 2.08, called d1oafa1