Lineage for d1oafa_ (1oaf A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445911Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 445912Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 445913Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 445914Protein Ascorbate peroxidase [48123] (3 species)
  7. 445922Species Soybean (Glycine max) [TaxId:3847] [89092] (3 PDB entries)
  8. 445923Domain d1oafa_: 1oaf A: [86734]

Details for d1oafa_

PDB Entry: 1oaf (more details), 1.4 Å

PDB Description: ascobate peroxidase from soybean cytosol in complex with ascorbate

SCOP Domain Sequences for d1oafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max)}
sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgti
khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
klselgfada

SCOP Domain Coordinates for d1oafa_:

Click to download the PDB-style file with coordinates for d1oafa_.
(The format of our PDB-style files is described here.)

Timeline for d1oafa_: