Lineage for d1oa9a_ (1oa9 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070519Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2070520Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2070521Family b.52.1.1: Eng V-like [50686] (3 proteins)
  6. 2070525Protein Endoglucanase V (Eng V) [50687] (2 species)
  7. 2070531Species Fungus (Melanocarpus albomyces) [TaxId:204285] [89353] (3 PDB entries)
  8. 2070534Domain d1oa9a_: 1oa9 A: [86733]

Details for d1oa9a_

PDB Entry: 1oa9 (more details), 2 Å

PDB Description: structure of melanocarpus albomyces endoglucanase
PDB Compounds: (A:) cellulase

SCOPe Domain Sequences for d1oa9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oa9a_ b.52.1.1 (A:) Endoglucanase V (Eng V) {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
angqstrywdcckpscgwrgkgpvnqpvyscdanfqrihdfdavsgceggpafscadhsp
waindnlsygfaatalsgqteeswccacyaltftsgpvagktmvvqststggdlgsnhfd
lnipgggvglfdgctpqfgglpgaryggissrqecdsfpeplkpgcqwrfdwfqnadnps
ftfervqcpeelvartgcrrhddggfav

SCOPe Domain Coordinates for d1oa9a_:

Click to download the PDB-style file with coordinates for d1oa9a_.
(The format of our PDB-style files is described here.)

Timeline for d1oa9a_: