Lineage for d1oa4a_ (1oa4 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 664069Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 664070Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 664097Species Streptomyces sp. 11ag8 [TaxId:133452] [89274] (1 PDB entry)
  8. 664098Domain d1oa4a_: 1oa4 A: [86731]

Details for d1oa4a_

PDB Entry: 1oa4 (more details), 1.5 Å

PDB Description: comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability
PDB Compounds: (A:) endo-beta-1,4-glucanase

SCOP Domain Sequences for d1oa4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oa4a_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Streptomyces sp. 11ag8 [TaxId: 133452]}
nqqicdrygtttiqdryvvqnnrwgtsatqcinvtgngfeitqadgsvptngapksypsv
ydgchygncaprttlpmrissigsapssvsyrytgngvynaaydiwldptprtngvnrte
imiwfnrvgpvqpigspvgtahvggrswevwtgsngsndvisflapsaisswsfdvkdfv
dqavshglatpdwyltsiqagfepweggtglavnsfssavna

SCOP Domain Coordinates for d1oa4a_:

Click to download the PDB-style file with coordinates for d1oa4a_.
(The format of our PDB-style files is described here.)

Timeline for d1oa4a_: