Lineage for d1oa3d_ (1oa3 D:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 295061Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 295062Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (6 species)
  7. 295066Species Hypocrea schweinitzii [TaxId:36924] [89276] (1 PDB entry)
  8. 295070Domain d1oa3d_: 1oa3 D: [86730]
    complexed with nag, pca

Details for d1oa3d_

PDB Entry: 1oa3 (more details), 1.7 Å

PDB Description: comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability

SCOP Domain Sequences for d1oa3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oa3d_ b.29.1.11 (D:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Hypocrea schweinitzii}
etscdqyatfsgngyivsnnlwgasagsgfgcvtsvslngaaswhadwqwsggqnnvksy
qnvqinipqkrtvnsigsmpttaswsysgsdiranvaydlftaanpnhvtysgdyelmiw
lgkygdigpigssqgtvnvggqtwtlyygyngamqvysfvaqsnttsysgdvknffnylr
dnkgynaggqyvlsyqfgtepftgsgtlnvaswtasin

SCOP Domain Coordinates for d1oa3d_:

Click to download the PDB-style file with coordinates for d1oa3d_.
(The format of our PDB-style files is described here.)

Timeline for d1oa3d_: