Lineage for d1oa3c_ (1oa3 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051304Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2051305Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)
  7. 2051315Species Hypocrea schweinitzii [TaxId:36924] [89276] (1 PDB entry)
  8. 2051318Domain d1oa3c_: 1oa3 C: [86729]
    complexed with nag

Details for d1oa3c_

PDB Entry: 1oa3 (more details), 1.7 Å

PDB Description: comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability
PDB Compounds: (C:) endo-beta-1-4-glucanase

SCOPe Domain Sequences for d1oa3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oa3c_ b.29.1.11 (C:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Hypocrea schweinitzii [TaxId: 36924]}
etscdqyatfsgngyivsnnlwgasagsgfgcvtsvslngaaswhadwqwsggqnnvksy
qnvqinipqkrtvnsigsmpttaswsysgsdiranvaydlftaanpnhvtysgdyelmiw
lgkygdigpigssqgtvnvggqtwtlyygyngamqvysfvaqsnttsysgdvknffnylr
dnkgynaggqyvlsyqfgtepftgsgtlnvaswtasin

SCOPe Domain Coordinates for d1oa3c_:

Click to download the PDB-style file with coordinates for d1oa3c_.
(The format of our PDB-style files is described here.)

Timeline for d1oa3c_: