SCOPe 2.05: Domain d1oa3a_: 1oa3 A:

Lineage for d1oa3a_ (1oa3 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (7 species)

7. Species Hypocrea schweinitzii [TaxId:36924] [89276] (1 PDB entry)

8. Domain d1oa3a_: 1oa3 A: [86727]
   complexed with nag

Details for d1oa3a_

PDB Entry: 1oa3, 1.7 Å

PDB Description: comparison of family 12 glycoside hydrolases and recruited substitutions important for thermal stability

PDB Compounds: (A:) endo-beta-1-4-glucanase

SCOPe Domain Sequences for d1oa3a_:

Sequence; same for both SEQRES and ATOM records:

>d1oa3a_ b.29.1.11 (A:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Hypocrea schweinitzii [TaxId: 36924]}
etscdqyatfsgngyivsnnlwgasagsgfgcvtsvslngaaswhadwqwsggqnnvksy
qnvqinipqkrtvnsigsmpttaswsysgsdiranvaydlftaanpnhvtysgdyelmiw
lgkygdigpigssqgtvnvggqtwtlyygyngamqvysfvaqsnttsysgdvknffnylr
dnkgynaggqyvlsyqfgtepftgsgtlnvaswtasin

Timeline for d1oa3a_:

• d1oa3a_ first appeared in SCOP 1.65
  
• d1oa3a_ appears in SCOPe 2.04
  
• d1oa3a_ appears in SCOPe 2.06
  
• d1oa3a_ appears in the current release, SCOPe 2.08