![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) |
![]() | Protein Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain [49991] (6 species) |
![]() | Species Trichoderma reesei, Cel12A [TaxId:51453] [63731] (2 PDB entries) |
![]() | Domain d1oa2f_: 1oa2 F: [86726] complexed with nag, pca; mutant |
PDB Entry: 1oa2 (more details), 1.5 Å
SCOP Domain Sequences for d1oa2f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oa2f_ b.29.1.11 (F:) Family 12 endo-1,4-beta-glucanase (cellulase) catalytic domain {Trichoderma reesei, Cel12A} etscdqwatftgngytvsnnlwgasagsgfgcvtvvslsggaswhadwqwsggqnnvksy qnsqiaipqkrtvnsissmpttaswsysgsniranvaydlftaanpnhvtysgdyelmiw lgkygdigpigssqgtvnvggqswtlyygyngamqvysfvaqtnttnysgdvknffnylr dnkgynaagqyvlsyqfgtepftgsgtlnvaswtasin
Timeline for d1oa2f_: