Lineage for d1o9wa_ (1o9w A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2040316Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2040518Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2040818Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
    automatically mapped to Pfam PF09222
  6. 2040819Protein Fimbrial adhesin F17-AG lectin domain [89216] (1 species)
  7. 2040820Species Escherichia coli [TaxId:562] [89217] (7 PDB entries)
  8. 2040822Domain d1o9wa_: 1o9w A: [86713]
    complexed with nag

Details for d1o9wa_

PDB Entry: 1o9w (more details), 1.65 Å

PDB Description: f17-ag lectin domain from escherichia coli in complex with n-acetyl- glucosamine
PDB Compounds: (A:) f17a-g fimbrial adhesin

SCOPe Domain Sequences for d1o9wa_:

Sequence, based on SEQRES records: (download)

>d1o9wa_ b.2.3.5 (A:) Fimbrial adhesin F17-AG lectin domain {Escherichia coli [TaxId: 562]}
avsfigstendvgpslgsysrthamdnlpfvydtrnkigyqnanvwhiskgfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtkysrgtamsgnswenvfsgwcvgantastqg
lsvrvtpvilkrnssarysvqktsigsirmrpyngssagsvqttvnfslnpftlnd

Sequence, based on observed residues (ATOM records): (download)

>d1o9wa_ b.2.3.5 (A:) Fimbrial adhesin F17-AG lectin domain {Escherichia coli [TaxId: 562]}
avsfigstendvgpslgsysrlpfvydtrnkigyqnanvwhiskgfcvgldgkvdlpvvg
sldgqsiyglteevglliwmgdtkysrgtamsgnswenvfsgwcvgantastqglsvrvt
pvilkrnsarysvqktsigsirmrpyngssagsvqttvnfslnpftlnd

SCOPe Domain Coordinates for d1o9wa_:

Click to download the PDB-style file with coordinates for d1o9wa_.
(The format of our PDB-style files is described here.)

Timeline for d1o9wa_: