Lineage for d1o9re_ (1o9r E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701716Species Agrobacterium tumefaciens, Dps [TaxId:358] [89027] (1 PDB entry)
  8. 2701721Domain d1o9re_: 1o9r E: [86710]
    complexed with edo, fe, trs

Details for d1o9re_

PDB Entry: 1o9r (more details), 1.45 Å

PDB Description: the x-ray crystal structure of agrobacterium tumefaciens dps, a member of the family that protect dna without binding
PDB Compounds: (E:) agrobacterium tumefaciens dps

SCOPe Domain Sequences for d1o9re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9re_ a.25.1.1 (E:) Dodecameric ferritin homolog {Agrobacterium tumefaciens, Dps [TaxId: 358]}
mkthktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrt
qldnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanm
irkaiddsdeagdpttadiftaasrdldkslwfleahvqeks

SCOPe Domain Coordinates for d1o9re_:

Click to download the PDB-style file with coordinates for d1o9re_.
(The format of our PDB-style files is described here.)

Timeline for d1o9re_: