Lineage for d1o9rd_ (1o9r D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766238Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 766239Species Agrobacterium tumefaciens, Dps [TaxId:358] [89027] (1 PDB entry)
  8. 766243Domain d1o9rd_: 1o9r D: [86709]

Details for d1o9rd_

PDB Entry: 1o9r (more details), 1.45 Å

PDB Description: the x-ray crystal structure of agrobacterium tumefaciens dps, a member of the family that protect dna without binding
PDB Compounds: (D:) agrobacterium tumefaciens dps

SCOP Domain Sequences for d1o9rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9rd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Agrobacterium tumefaciens, Dps [TaxId: 358]}
thktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrtql
dnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanmir
kaiddsdeagdpttadiftaasrdldkslwfleahvqeks

SCOP Domain Coordinates for d1o9rd_:

Click to download the PDB-style file with coordinates for d1o9rd_.
(The format of our PDB-style files is described here.)

Timeline for d1o9rd_: