Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (9 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Agrobacterium tumefaciens, Dps [TaxId:358] [89027] (1 PDB entry) |
Domain d1o9rb_: 1o9r B: [86707] |
PDB Entry: 1o9r (more details), 1.45 Å
SCOP Domain Sequences for d1o9rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9rb_ a.25.1.1 (B:) Dodecameric ferritin homolog {Agrobacterium tumefaciens, Dps [TaxId: 358]} mkthktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrt qldnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanm irkaiddsdeagdpttadiftaasrdldkslwfleahvqeks
Timeline for d1o9rb_: