Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (16 species) |
Species Agrobacterium tumefaciens, Dps [TaxId:358] [89027] (1 PDB entry) |
Domain d1o9ra_: 1o9r A: [86706] complexed with edo, fe, trs |
PDB Entry: 1o9r (more details), 1.45 Å
SCOPe Domain Sequences for d1o9ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9ra_ a.25.1.1 (A:) Dodecameric ferritin homolog {Agrobacterium tumefaciens, Dps [TaxId: 358]} mkthktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrt qldnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanm irkaiddsdeagdpttadiftaasrdldkslwfleahvqeks
Timeline for d1o9ra_: