SCOPe 2.07: Domain d1o9ra_: 1o9r A:

Lineage for d1o9ra_ (1o9r A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Dodecameric ferritin homolog [47250] (16 species)

7. Species Agrobacterium tumefaciens, Dps [TaxId:358] [89027] (1 PDB entry)

8. Domain d1o9ra_: 1o9r A: [86706]
   complexed with edo, fe, trs

Details for d1o9ra_

PDB Entry: 1o9r, 1.45 Å

PDB Description: the x-ray crystal structure of agrobacterium tumefaciens dps, a member of the family that protect dna without binding

PDB Compounds: (A:) agrobacterium tumefaciens dps

SCOPe Domain Sequences for d1o9ra_:

Sequence; same for both SEQRES and ATOM records:

>d1o9ra_ a.25.1.1 (A:) Dodecameric ferritin homolog {Agrobacterium tumefaciens, Dps [TaxId: 358]}
mkthktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrt
qldnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanm
irkaiddsdeagdpttadiftaasrdldkslwfleahvqeks

Timeline for d1o9ra_:

• d1o9ra_ first appeared in SCOP 1.65
  
• d1o9ra_ appears in SCOPe 2.06
  
• d1o9ra_ appears in the current release, SCOPe 2.08