SCOP 1.73: Domain d1o9kg_: 1o9k G:

Lineage for d1o9kg_ (1o9k G:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (5 PDB entries)

8. Domain d1o9kg_: 1o9k G: [86704]

Details for d1o9kg_

PDB Entry: 1o9k, 2.6 Å

PDB Description: crystal structure of the retinoblastoma tumour suppressor protein bound to e2f peptide

PDB Compounds: (G:) retinoblastoma tumour suppressor protein

SCOP Domain Sequences for d1o9kg_:

Sequence, based on SEQRES records:

>d1o9kg_ a.74.1.3 (G:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgc
veigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
srstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrim
eslawlsdsplfdlikqskd

Sequence, based on observed residues (ATOM records):

>d1o9kg_ a.74.1.3 (G:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgc
veigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
srssgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawl
sdsplfdlikqskd

Timeline for d1o9kg_:

• d1o9kg_ first appeared in SCOP 1.65
  
• d1o9kg_ appears in SCOP 1.71
  
• d1o9kg_ appears in SCOP 1.75
  
• d1o9kg_ appears in the current release, SCOPe 2.08