Lineage for d1o9ke_ (1o9k E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331800Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 2331801Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 2331802Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)
  8. 2331818Domain d1o9ke_: 1o9k E: [86702]
    domain A - chains A, C, E, G; domain B - chains B, D, F, H; complexed with E2F peptide, chains P, Q, R, S

Details for d1o9ke_

PDB Entry: 1o9k (more details), 2.6 Å

PDB Description: crystal structure of the retinoblastoma tumour suppressor protein bound to e2f peptide
PDB Compounds: (E:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d1o9ke_:

Sequence, based on SEQRES records: (download)

>d1o9ke_ a.74.1.3 (E:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgc
veigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
srstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrim
eslawlsdsplfdlikqskd

Sequence, based on observed residues (ATOM records): (download)

>d1o9ke_ a.74.1.3 (E:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
mntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgc
veigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmaty
srssgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrimeslawl
sdsplfdlikqskd

SCOPe Domain Coordinates for d1o9ke_:

Click to download the PDB-style file with coordinates for d1o9ke_.
(The format of our PDB-style files is described here.)

Timeline for d1o9ke_: