SCOP 1.71: Domain d1o9kd_: 1o9k D:

Lineage for d1o9kd_ (1o9k D:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (5 PDB entries)

8. Domain d1o9kd_: 1o9k D: [86701]

Details for d1o9kd_

PDB Entry: 1o9k, 2.6 Å

PDB Description: crystal structure of the retinoblastoma tumour suppressor protein bound to e2f peptide

SCOP Domain Sequences for d1o9kd_:

Sequence; same for both SEQRES and ATOM records:

>d1o9kd_ a.74.1.3 (D:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)}
stslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqi
mmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqr
lktnilqyastrpptlspiphipr

Timeline for d1o9kd_:

• d1o9kd_ first appeared in SCOP 1.65
  
• d1o9kd_ appears in SCOP 1.69
  
• d1o9kd_ appears in SCOP 1.73
  
• d1o9kd_ appears in the current release, SCOPe 2.08