Lineage for d1o9ja_ (1o9j A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140678Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species)
  7. 2140697Species Elephant shrew (Elephantulus edwardii) [TaxId:28737] [89780] (1 PDB entry)
    cytosolic form; eta-crystallin
  8. 2140698Domain d1o9ja_: 1o9j A: [86694]
    complexed with dtt, dtu, nad

Details for d1o9ja_

PDB Entry: 1o9j (more details), 2.4 Å

PDB Description: the x-ray crystal structure of eta-crystallin
PDB Compounds: (A:) aldehyde dehydrogenase, cytosolic 1

SCOPe Domain Sequences for d1o9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9ja_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Elephant shrew (Elephantulus edwardii) [TaxId: 28737]}
dlpapltnikiqhtklfinnewhesvsgktfpvfnpateekiceveeadkedvdkavkaa
reafqmgspwrtmdasergqliykladlierdrlllatlesinagkvfasaylmdldyci
kalrycagwadkiqgrtipvdgeffsytrhepigvcglifpwnapmillackigpalccg
ntvivkpaeqtpltalhvaslikeagfppgvvnivpgygptagaaisshmdvdkvaftgs
tevgkmiqeaaaksnlkrvtlelgaknpcivfadadldsavefahqgvftnqgqsciaas
klfveeaiydefvqrsverakkyvfgnpltpgvnhgpqinkaqhnkimeliesgkkegak
lecgggpwgnkgyfiqptvfsnvtddmriakeeifgpvqqimkfksldevikranntyyg
lvagvftkdldkavtvssalqagtvwvncylaasaqspaggfkmsghgremgeygiheyt
evktvtmkisekns

SCOPe Domain Coordinates for d1o9ja_:

Click to download the PDB-style file with coordinates for d1o9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1o9ja_: