Lineage for d1o9ga_ (1o9g A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130125Family c.66.1.29: rRNA methyltransferase AviRa [89738] (1 protein)
    automatically mapped to Pfam PF11599
  6. 2130126Protein rRNA methyltransferase AviRa [89739] (1 species)
  7. 2130127Species Streptomyces viridochromogenes [TaxId:1938] [89740] (2 PDB entries)
  8. 2130128Domain d1o9ga_: 1o9g A: [86692]

Details for d1o9ga_

PDB Entry: 1o9g (more details), 1.5 Å

PDB Description: rrna methyltransferase avira from streptomyces viridochromogenes at 1.5a
PDB Compounds: (A:) rRNA methyltransferase

SCOPe Domain Sequences for d1o9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]}
sayrhavermdssdlacgvvlhsapgypafpvrlateifqralarlpgdgpvtlwdpccg
sgylltvlgllhrrslrqviasdvdpaplelaaknlallspagltarelerreqserfgk
psyleaaqaarrlrerltaeggalpcairtadvfdpralsavlagsapdvvltdlpyger
thwegqvpgqpvagllrslasalpahaviavtdrsrkipvapvkalerlkigtrsavmvr
aadvleagp

SCOPe Domain Coordinates for d1o9ga_:

Click to download the PDB-style file with coordinates for d1o9ga_.
(The format of our PDB-style files is described here.)

Timeline for d1o9ga_: