SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1o9ca_ (1o9c A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007229Protein 14-3-3-like protein C [89132] (1 species)
  7. 2007230Species Tobacco (Nicotiana tabacum) [TaxId:4097] [89133] (5 PDB entries)
  8. 2007232Domain d1o9ca_: 1o9c A: [86688]
    complexed with cl, flc

Details for d1o9ca_

PDB Entry: 1o9c (more details), 2.6 Å

PDB Description: structural view of a fungal toxin acting on a 14-3-3 regulatory complex
PDB Compounds: (A:) 14-3-3-like protein c

SCOPe Domain Sequences for d1o9ca_:

Sequence, based on SEQRES records: (download)

>d1o9ca_ a.118.7.1 (A:) 14-3-3-like protein C {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
ptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarra
swriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgdsk
vfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnfs
vfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd

Sequence, based on observed residues (ATOM records): (download)

>d1o9ca_ a.118.7.1 (A:) 14-3-3-like protein C {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
ptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarra
swriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgdsk
vfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnfs
vfyyeilnspdracnlakqafdeaiaeldtlgkdstlimqllrdnltlwtsd

SCOPe Domain Coordinates for d1o9ca_:

Click to download the PDB-style file with coordinates for d1o9ca_.
(The format of our PDB-style files is described here.)

Timeline for d1o9ca_: