SCOPe 2.05: Domain d1o98a2: 1o98 A:2-76,A:311-510

Lineage for d1o98a2 (1o98 A:2-76,A:311-510)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
   core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest

4. Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families)

5. Family c.76.1.3: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain [64162] (1 protein)

6. Protein 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain [64163] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [64164] (4 PDB entries)

8. Domain d1o98a2: 1o98 A:2-76,A:311-510 [86685]
   Other proteins in same PDB: d1o98a1
   complexed with 2pg, mn, so4

Details for d1o98a2

PDB Entry: 1o98, 1.4 Å

PDB Description: 1.4a crystal structure of phosphoglycerate mutase from bacillus stearothermophilus complexed with 2-phosphoglycerate

PDB Compounds: (A:) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase

SCOPe Domain Sequences for d1o98a2:

Sequence; same for both SEQRES and ATOM records:

>d1o98a2 c.76.1.3 (A:2-76,A:311-510) 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
skkpvaliildgfalrdetygnavaqankpnfdrywneyphttlkacgeavglpegqmgn
sevghlnigagrivyXtnldntigevlsqhglrqlriaetekyphvtffmsggreeefpg
edrilinspkvptydlkpemsayevtdallkeieadkydaiilnyanpdmvghsgklept
ikaveavdeclgkvvdailakggiaiitadhgnadevltpdgkpqtahttnpvpvivtkk
giklrdggilgdlaptmldllglpqpkemtgksliv

Timeline for d1o98a2:

• d1o98a2 first appeared in SCOP 1.65
  
• d1o98a2 appears in SCOPe 2.04
  
• d1o98a2 appears in SCOPe 2.06
  
• d1o98a2 appears in the current release, SCOPe 2.08