SCOPe 2.07: Domain d1o98a1: 1o98 A:77-310

Lineage for d1o98a1 (1o98 A:77-310)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.105: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64157] (1 superfamily)
   core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 45321678, strands 4 and 5 are antiparallel to the rest

4. Superfamily c.105.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64158] (1 family)
   automatically mapped to Pfam PF06415

5. Family c.105.1.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64159] (1 protein)

6. Protein 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64160] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [64161] (4 PDB entries)

8. Domain d1o98a1: 1o98 A:77-310 [86684]
   Other proteins in same PDB: d1o98a2
   complexed with 2pg, mn, so4

Details for d1o98a1

PDB Entry: 1o98, 1.4 Å

PDB Description: 1.4a crystal structure of phosphoglycerate mutase from bacillus stearothermophilus complexed with 2-phosphoglycerate

PDB Compounds: (A:) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase

SCOPe Domain Sequences for d1o98a1:

Sequence; same for both SEQRES and ATOM records:

>d1o98a1 c.105.1.1 (A:77-310) 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain {Bacillus stearothermophilus [TaxId: 1422]}
qsltriniairegefdrnetflaamnhvkqhgtslhlfgllsdggvhshihhlyallrla
akegvkrvyihgfldgrdvgpqtapqyikelqekikeygvgeiatlsgryysmdrdkrwd
rvekayramvygegptyrdpleciedsykhgiydefvlpsvivredgrpvatiqdndaii
fynfrpdraiqisntftnedfrefdrgpkhpkhlffvclthfsetvagyvafkp

Timeline for d1o98a1:

• d1o98a1 first appeared in SCOP 1.65
  
• d1o98a1 appears in SCOPe 2.06