![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.105: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64157] (1 superfamily) core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 45321678, strands 4 and 5 are antiparallel to the rest |
![]() | Superfamily c.105.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64158] (1 family) ![]() automatically mapped to Pfam PF06415 |
![]() | Family c.105.1.1: 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64159] (1 protein) |
![]() | Protein 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain [64160] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [64161] (4 PDB entries) |
![]() | Domain d1o98a1: 1o98 A:77-310 [86684] Other proteins in same PDB: d1o98a2 complexed with 2pg, mn, so4 |
PDB Entry: 1o98 (more details), 1.4 Å
SCOPe Domain Sequences for d1o98a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o98a1 c.105.1.1 (A:77-310) 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain {Bacillus stearothermophilus [TaxId: 1422]} qsltriniairegefdrnetflaamnhvkqhgtslhlfgllsdggvhshihhlyallrla akegvkrvyihgfldgrdvgpqtapqyikelqekikeygvgeiatlsgryysmdrdkrwd rvekayramvygegptyrdpleciedsykhgiydefvlpsvivredgrpvatiqdndaii fynfrpdraiqisntftnedfrefdrgpkhpkhlffvclthfsetvagyvafkp
Timeline for d1o98a1: