Lineage for d1o8va_ (1o8v A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063209Protein Fatty acid-binding protein homolog 1 [89366] (1 species)
  7. 2063210Species Flat worm (Echinococcus granulosus) [TaxId:6210] [89367] (1 PDB entry)
  8. 2063211Domain d1o8va_: 1o8v A: [86680]
    complexed with plm

Details for d1o8va_

PDB Entry: 1o8v (more details), 1.6 Å

PDB Description: the crystal structure of echinococcus granulosus fatty-acid-binding protein 1
PDB Compounds: (A:) fatty acid binding protein homolog

SCOPe Domain Sequences for d1o8va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8va_ b.60.1.2 (A:) Fatty acid-binding protein homolog 1 {Flat worm (Echinococcus granulosus) [TaxId: 6210]}
meaflgtwkmeksegfdkimerlgvdfvtrkmgnlvkpnlivtdlgggkykmrsestfkt
tecsfklgekfkevtpdsrevaslitvengvmkheqddktkvtyiervvegnelkatvkv
devvcvrtyskva

SCOPe Domain Coordinates for d1o8va_:

Click to download the PDB-style file with coordinates for d1o8va_.
(The format of our PDB-style files is described here.)

Timeline for d1o8va_: