Lineage for d1o8qc_ (1o8q C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317586Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 317587Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 317588Family c.57.1.1: MogA-like [53219] (4 proteins)
  6. 317604Protein Plant CNX1 G domain [69537] (1 species)
    gephyrin homologue
  7. 317605Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [69538] (3 PDB entries)
  8. 317608Domain d1o8qc_: 1o8q C: [86671]

Details for d1o8qc_

PDB Entry: 1o8q (more details), 2.6 Å

PDB Description: the active site of the molybdenum cofactor biosenthetic protein domain cnx1g

SCOP Domain Sequences for d1o8qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o8qc_ c.57.1.1 (C:) Plant CNX1 G domain {Mouse-ear cress (Arabidopsis thaliana)}
eykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdilq
kwsdvdemdliltlggtgftprdvtpeatkkvieretpgllfvmmqealkitpfamlsrs
aagirgstliinmpgnpnavaecmeallpalkhalkqikg

SCOP Domain Coordinates for d1o8qc_:

Click to download the PDB-style file with coordinates for d1o8qc_.
(The format of our PDB-style files is described here.)

Timeline for d1o8qc_: