Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) |
Family c.57.1.1: MogA-like [53219] (4 proteins) |
Protein Plant CNX1 G domain [69537] (1 species) gephyrin homologue |
Species Mouse-ear cress (Arabidopsis thaliana) [TaxId:3702] [69538] (3 PDB entries) |
Domain d1o8nb_: 1o8n B: [86666] |
PDB Entry: 1o8n (more details), 2.8 Å
SCOP Domain Sequences for d1o8nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o8nb_ c.57.1.1 (B:) Plant CNX1 G domain {Mouse-ear cress (Arabidopsis thaliana)} gpeykvailtvsdtvsagagpdrsgpravsvvdssseklggakvvatavvpdeverikdi lqkwsdvdemdliltlggagftprdvtpeatkkvieretpgllfvmmqeslkitpfamls rsaagirgstliinmpgnpnavaecmeallpalkhalkqikgd
Timeline for d1o8nb_: