Lineage for d1o7zb_ (1o7z B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499233Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2499234Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2499235Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)
  6. 2499291Protein IP-10/CXCL10 [82573] (1 species)
  7. 2499292Species Human (Homo sapiens) [TaxId:9606] [82574] (4 PDB entries)
  8. 2499296Domain d1o7zb_: 1o7z B: [86661]

Details for d1o7zb_

PDB Entry: 1o7z (more details), 1.92 Å

PDB Description: crystal structure of ip-10 t-form
PDB Compounds: (B:) Small inducible cytokine B10

SCOPe Domain Sequences for d1o7zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7zb_ d.9.1.1 (B:) IP-10/CXCL10 {Human (Homo sapiens) [TaxId: 9606]}
ctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaiknl

SCOPe Domain Coordinates for d1o7zb_:

Click to download the PDB-style file with coordinates for d1o7zb_.
(The format of our PDB-style files is described here.)

Timeline for d1o7zb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o7za_