Lineage for d1o7yc_ (1o7y C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890825Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1890826Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1890827Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1890882Protein IP-10/CXCL10 [82573] (1 species)
  7. 1890883Species Human (Homo sapiens) [TaxId:9606] [82574] (4 PDB entries)
  8. 1890890Domain d1o7yc_: 1o7y C: [86658]
    complexed with so4

Details for d1o7yc_

PDB Entry: 1o7y (more details), 3 Å

PDB Description: crystal structure of ip-10 m-form
PDB Compounds: (C:) Small inducible cytokine B10

SCOPe Domain Sequences for d1o7yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7yc_ d.9.1.1 (C:) IP-10/CXCL10 {Human (Homo sapiens) [TaxId: 9606]}
vrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaiknllk
avsk

SCOPe Domain Coordinates for d1o7yc_:

Click to download the PDB-style file with coordinates for d1o7yc_.
(The format of our PDB-style files is described here.)

Timeline for d1o7yc_: