![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.9: IL8-like [54116] (1 superfamily) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins) |
![]() | Protein IP-10/CXCL10 [82573] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82574] (4 PDB entries) |
![]() | Domain d1o7yb_: 1o7y B: [86657] |
PDB Entry: 1o7y (more details), 3 Å
SCOP Domain Sequences for d1o7yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o7yb_ d.9.1.1 (B:) IP-10/CXCL10 {Human (Homo sapiens)} ctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaiknllkav ske
Timeline for d1o7yb_: