Lineage for d1o7yb_ (1o7y B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929037Protein IP-10/CXCL10 [82573] (1 species)
  7. 2929038Species Human (Homo sapiens) [TaxId:9606] [82574] (4 PDB entries)
  8. 2929044Domain d1o7yb_: 1o7y B: [86657]
    complexed with so4

Details for d1o7yb_

PDB Entry: 1o7y (more details), 3 Å

PDB Description: crystal structure of ip-10 m-form
PDB Compounds: (B:) Small inducible cytokine B10

SCOPe Domain Sequences for d1o7yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7yb_ d.9.1.1 (B:) IP-10/CXCL10 {Human (Homo sapiens) [TaxId: 9606]}
ctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeskaiknllkav
ske

SCOPe Domain Coordinates for d1o7yb_:

Click to download the PDB-style file with coordinates for d1o7yb_.
(The format of our PDB-style files is described here.)

Timeline for d1o7yb_: