Lineage for d1o7va_ (1o7v A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023658Protein N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) [89176] (1 species)
  7. 2023659Species Human (Homo sapiens) [TaxId:9606] [89177] (6 PDB entries)
  8. 2023664Domain d1o7va_: 1o7v A: [86655]

Details for d1o7va_

PDB Entry: 1o7v (more details), 1.9 Å

PDB Description: high resolution structure of siglec-7
PDB Compounds: (A:) Sialic acid binding Ig-like lectin 7

SCOPe Domain Sequences for d1o7va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7va_ b.1.1.1 (A:) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
gqksnrkdysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkap
vatnnpawavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykyd
qlsvnvt

SCOPe Domain Coordinates for d1o7va_:

Click to download the PDB-style file with coordinates for d1o7va_.
(The format of our PDB-style files is described here.)

Timeline for d1o7va_: