SCOP 1.73: Domain d1o7ib_: 1o7i B:

Lineage for d1o7ib_ (1o7i B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
   barrel, closed; n=5, S=10

6. Protein Archaeal ssDNA-binding protein [89324] (1 species)
   similar to the domains of the Replication protein A

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89325] (1 PDB entry)

8. Domain d1o7ib_: 1o7i B: [86643]
   complexed with so4

Details for d1o7ib_

PDB Entry: 1o7i, 1.2 Å

PDB Description: crystal structure of a single stranded dna binding protein

PDB Compounds: (B:) single stranded DNA binding protein

SCOP Domain Sequences for d1o7ib_:

Sequence; same for both SEQRES and ATOM records:

>d1o7ib_ b.40.4.3 (B:) Archaeal ssDNA-binding protein {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
meekvgnlkpnmesvnvtvrvleasearqiqtkngvrtiseaivgdetgrvkltlwgkha
gsikegqvvkienawttafkgqvqlnagsktkiaeasedgfpessqipentpta

Timeline for d1o7ib_:

• d1o7ib_ first appeared in SCOP 1.65
  
• d1o7ib_ appears in SCOP 1.71
  
• d1o7ib_ appears in SCOP 1.75
  
• d1o7ib_ appears in the current release, SCOPe 2.08