Lineage for d1o7ib_ (1o7i B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668080Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 668081Protein Archaeal ssDNA-binding protein [89324] (1 species)
    similar to the domains of the Replication protein A
  7. 668082Species Archaeon Sulfolobus solfataricus [TaxId:2287] [89325] (1 PDB entry)
  8. 668084Domain d1o7ib_: 1o7i B: [86643]
    complexed with so4

Details for d1o7ib_

PDB Entry: 1o7i (more details), 1.2 Å

PDB Description: crystal structure of a single stranded dna binding protein
PDB Compounds: (B:) single stranded DNA binding protein

SCOP Domain Sequences for d1o7ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7ib_ b.40.4.3 (B:) Archaeal ssDNA-binding protein {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
meekvgnlkpnmesvnvtvrvleasearqiqtkngvrtiseaivgdetgrvkltlwgkha
gsikegqvvkienawttafkgqvqlnagsktkiaeasedgfpessqipentpta

SCOP Domain Coordinates for d1o7ib_:

Click to download the PDB-style file with coordinates for d1o7ib_.
(The format of our PDB-style files is described here.)

Timeline for d1o7ib_: