SCOPe 2.02: Domain d1o7d.3: 1o7d A:51-342,B:347-384

Lineage for d1o7d.3 (1o7d A:51-342,B:347-384)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
   variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands

4. Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families)
   in the different families beta-barrels are similarly distorted but may vary in the number of strands

5. Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family

6. Protein Lysosomal alpha-mannosidase [89557] (1 species)
   the single-chain precursor is processed into 5 peptides; heavily glycosylated

7. Species Cow (Bos taurus) [TaxId:9913] [89558] (1 PDB entry)

8. Domain d1o7d.3: 1o7d A:51-342,B:347-384 [86641]
   Other proteins in same PDB: d1o7d.1, d1o7d.2
   complexed with nag, so4, trs, zn

Details for d1o7d.3

PDB Entry: 1o7d, 2.7 Å

PDB Description: the structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation

PDB Compounds: (A:) lysosomal alpha-mannosidase, (B:) lysosomal alpha-mannosidase

SCOPe Domain Sequences for d1o7d.3:

Sequence; same for both SEQRES and ATOM records:

>g1o7d.3 c.6.2.1 (A:51-342,B:347-384) Lysosomal alpha-mannosidase {Cow (Bos taurus) [TaxId: 9913]}
gyktcpkvkpdmlnvhlvphthddvgwlktvdqyfygiynniqpagvqyildsvisslla
nptrrfiyveiaffsrwwrqqtnatqkivrelvrqgrlefanggwvmndeatthygaiid
qmtlglrfleetfgsdgrprvawhidpfghsreqaslfaqmgfdgfffgrldyqdkkvrk
ktlqmeqvwrastslkpptadlftsvlpnmynppeglcwdmlcadkpvvedtrspeynak
elvryflklatdqgklyrtkhtvmtmgsdfqyenantwfknldkliqlvnaqXirvnvly
stpacylwelnkanlswsvkkddffpyadgp

Timeline for d1o7d.3:

• d1o7d.3 first appeared in SCOP 1.65
  
• d1o7d.3 appears in SCOPe 2.01
  
• d1o7d.3 appears in SCOPe 2.03
  
• d1o7d.3 appears in the current release, SCOPe 2.08