Lineage for d1o7d.3 (1o7d A:51-342,B:347-384)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 479595Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 479631Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (4 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 479632Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 479642Protein Lysosomal alpha-mannosidase [89557] (1 species)
    the single-chain precursor is processed into 5 peptides; heavily glycosylated
  7. 479643Species Cow (Bos taurus) [TaxId:9913] [89558] (1 PDB entry)
  8. 479644Domain d1o7d.3: 1o7d A:51-342,B:347-384 [86641]
    Other proteins in same PDB: d1o7d.1, d1o7d.2

Details for d1o7d.3

PDB Entry: 1o7d (more details), 2.7 Å

PDB Description: the structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation

SCOP Domain Sequences for d1o7d.3:

Sequence; same for both SEQRES and ATOM records: (download)

>g1o7d.3 c.6.2.1 (A:51-342,B:347-384) Lysosomal alpha-mannosidase {Cow (Bos taurus)}
gyktcpkvkpdmlnvhlvphthddvgwlktvdqyfygiynniqpagvqyildsvisslla
nptrrfiyveiaffsrwwrqqtnatqkivrelvrqgrlefanggwvmndeatthygaiid
qmtlglrfleetfgsdgrprvawhidpfghsreqaslfaqmgfdgfffgrldyqdkkvrk
ktlqmeqvwrastslkpptadlftsvlpnmynppeglcwdmlcadkpvvedtrspeynak
elvryflklatdqgklyrtkhtvmtmgsdfqyenantwfknldkliqlvnaqXirvnvly
stpacylwelnkanlswsvkkddffpyadgp

SCOP Domain Coordinates for d1o7d.3:

Click to download the PDB-style file with coordinates for d1o7d.3.
(The format of our PDB-style files is described here.)

Timeline for d1o7d.3: