Lineage for d1o7d.2 (1o7d C:488-585,D:603-875,E:885-1007)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2045015Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 protein domains)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 2045075Protein Lysosomal alpha-mannosidase [89289] (1 species)
    the single-chain precursor is processed into 5 peptides; heavily glycosylated
  7. 2045076Species Cow (Bos taurus) [TaxId:9913] [89290] (1 PDB entry)
  8. 2045077Domain d1o7d.2: 1o7d C:488-585,D:603-875,E:885-1007 [86640]
    Other proteins in same PDB: d1o7d.1, d1o7d.3
    complexed with nag, so4, trs, zn

Details for d1o7d.2

PDB Entry: 1o7d (more details), 2.7 Å

PDB Description: the structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation
PDB Compounds: (C:) lysosomal alpha-mannosidase, (D:) lysosomal alpha-mannosidase, (E:) lysosomal alpha-mannosidase

SCOPe Domain Sequences for d1o7d.2:

Sequence, based on SEQRES records: (download)

>g1o7d.2 b.30.5.6 (C:488-585,D:603-875,E:885-1007) Lysosomal alpha-mannosidase {Cow (Bos taurus) [TaxId: 9913]}
edfafcrklnisicpltqtaerfqvivynplgrkvdwmvrlpvskhvylvkdpggkivps
dvvtipssdsqellfsalvpavgfsiysvsqmpnXrdlviqneylrarfdpntgllmele
nleqnlllpvrqafywynastgnnlssqasgayifrpnqnkplfvshwaqthlvkaslvq
evhqnfsawcsqvvrlyprqrhlelewtvgpipvgdgwgkevisrfdtalatrglfytds
ngreilerrrnyrptwklnqtepvagnyypvnsriyitdgnmqltvltdrsqggsslrdg
slelmvhrrllkddargvgeplnkegsglwvrgrhlvlldkketaaarhrlqaemevlap
qvvlaqggXprtqfsglrrelppsvrlltlarwgpetlllrlehqfavgedsgrnlsspv
tldltnlfsaftitnlrettlaanqllayasrlqwttdtgptphpspsrpvsatitlqpm
eirtflasvqwe

Sequence, based on observed residues (ATOM records): (download)

>g1o7d.2 b.30.5.6 (C:488-585,D:603-875,E:885-1007) Lysosomal alpha-mannosidase {Cow (Bos taurus) [TaxId: 9913]}
edfafcrklnisicpltqtaerfqvivynplgrkvdwmvrlpvskhvylvkdpggkivps
dvvtipssdsqellfsalvpavgfsiysvsqmpnXrdlviqneylrarfdpntgllmele
nllllpvrqafywynastgnnlssqasgayifrpnqnkplfvshwaqthlvkaslvqevh
qnfsawcsqvvrlyprqrhlelewtvgpipvgdgwgkevisrfdtalatrglfytdsngr
eilerrrnyrptwklnqtepvagnyypvnsriyitdgnmqltvltdrsqggsslrdgsle
lmvhrrllkddargvgeplnkegsglwvrgrhlvlldkketaaarhrlqaemevlapqvv
laqggXprtqfsglrrelppsvrlltlarwgpetlllrlehqfavgedsgrnlsspvtld
ltnlfsaftitnlrettlaanqllayasrlqwttdatitlqpmeirtflasvqwe

SCOPe Domain Coordinates for d1o7d.2:

Click to download the PDB-style file with coordinates for d1o7d.2.
(The format of our PDB-style files is described here.)

Timeline for d1o7d.2: