![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families) ![]() |
![]() | Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family |
![]() | Protein Lysosomal alpha-mannosidase [89016] (1 species) the single-chain precursor is processed into 5 peptides; heavily glycosylated |
![]() | Species Cow (Bos taurus) [TaxId:9913] [89017] (1 PDB entry) |
![]() | Domain d1o7d.1: 1o7d B:385-422,C:431-487 [86639] Other proteins in same PDB: d1o7d.2, d1o7d.3 complexed with nag, so4, trs, zn |
PDB Entry: 1o7d (more details), 2.7 Å
SCOPe Domain Sequences for d1o7d.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1o7d.1 a.8.3.1 (B:385-422,C:431-487) Lysosomal alpha-mannosidase {Cow (Bos taurus) [TaxId: 9913]} ymfwtgyfssrpalkryerlsynflqvcnqlealagpaXgdsaplneamavlqhhdavsg tsrqhvandyarqlsegwrpcevlmsnalahlsglk
Timeline for d1o7d.1: