Lineage for d1o6pb_ (1o6p B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725423Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 2725501Protein Importin beta [48378] (3 species)
  7. 2725504Species Human (Homo sapiens) [TaxId:9606] [48379] (11 PDB entries)
  8. 2725515Domain d1o6pb_: 1o6p B: [86637]
    bound to a glfg nucleoporin peptide, chains C, D, E and F
    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1o6pb_

PDB Entry: 1o6p (more details), 2.8 Å

PDB Description: importin beta bound to a glfg nucleoporin peptide
PDB Compounds: (B:) importin beta-1 subunit

SCOPe Domain Sequences for d1o6pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6pb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpe

SCOPe Domain Coordinates for d1o6pb_:

Click to download the PDB-style file with coordinates for d1o6pb_.
(The format of our PDB-style files is described here.)

Timeline for d1o6pb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o6pa_