Lineage for d1o6pa_ (1o6p A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 284904Superfamily a.118.1: ARM repeat [48371] (13 families) (S)
  5. 284905Family a.118.1.1: Armadillo repeat [48372] (5 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 284931Protein Importin beta [48378] (2 species)
  7. 284932Species Human (Homo sapiens) [TaxId:9606] [48379] (6 PDB entries)
  8. 284939Domain d1o6pa_: 1o6p A: [86636]

Details for d1o6pa_

PDB Entry: 1o6p (more details), 2.8 Å

PDB Description: importin beta bound to a glfg nucleoporin peptide

SCOP Domain Sequences for d1o6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6pa_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens)}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlhtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpe

SCOP Domain Coordinates for d1o6pa_:

Click to download the PDB-style file with coordinates for d1o6pa_.
(The format of our PDB-style files is described here.)

Timeline for d1o6pa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o6pb_