Lineage for d1o6ib2 (1o6i B:3-291,B:380-446)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083165Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2083224Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 2083225Species Serratia marcescens [TaxId:615] [51547] (18 PDB entries)
  8. 2083229Domain d1o6ib2: 1o6i B:3-291,B:380-446 [86634]
    Other proteins in same PDB: d1o6ia1, d1o6ia3, d1o6ib1, d1o6ib3
    complexed with 0hz, gol, so4

Details for d1o6ib2

PDB Entry: 1o6i (more details), 1.7 Å

PDB Description: chitinase b from serratia marcescens complexed with the catalytic intermediate mimic cyclic dipeptide ci4.
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1o6ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o6ib2 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOPe Domain Coordinates for d1o6ib2:

Click to download the PDB-style file with coordinates for d1o6ib2.
(The format of our PDB-style files is described here.)

Timeline for d1o6ib2: