Lineage for d1o4wa_ (1o4w A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322958Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 322959Superfamily c.120.1: PIN domain-like [88723] (2 families) (S)
  5. 322960Family c.120.1.1: PIN domain [89619] (1 protein)
  6. 322961Protein Hypothetical protein AF0591 [89620] (1 species)
  7. 322962Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [89621] (1 PDB entry)
  8. 322963Domain d1o4wa_: 1o4w A: [86629]
    structural genomics
    complexed with mse

Details for d1o4wa_

PDB Entry: 1o4w (more details), 1.9 Å

PDB Description: crystal structure of a pin (pilt n-terminus) domain containing protein (af0591) from archaeoglobus fulgidus at 1.90 a resolution

SCOP Domain Sequences for d1o4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4wa_ c.120.1.1 (A:) Hypothetical protein AF0591 {Archaeon Archaeoglobus fulgidus}
kvrcavvdtnvlmyvylnkadvvgqlrefgfsrflitasvkreleklemslrgkekvaar
falkllehfevvetesegdpslieaaekygcilitndkelkrkakqrgipvgylkedkrv
fvell

SCOP Domain Coordinates for d1o4wa_:

Click to download the PDB-style file with coordinates for d1o4wa_.
(The format of our PDB-style files is described here.)

Timeline for d1o4wa_: