Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (2 families) |
Family c.120.1.1: PIN domain [89619] (1 protein) |
Protein Hypothetical protein AF0591 [89620] (1 species) |
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [89621] (1 PDB entry) |
Domain d1o4wa_: 1o4w A: [86629] structural genomics complexed with mse |
PDB Entry: 1o4w (more details), 1.9 Å
SCOP Domain Sequences for d1o4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o4wa_ c.120.1.1 (A:) Hypothetical protein AF0591 {Archaeon Archaeoglobus fulgidus} kvrcavvdtnvlmyvylnkadvvgqlrefgfsrflitasvkreleklemslrgkekvaar falkllehfevvetesegdpslieaaekygcilitndkelkrkakqrgipvgylkedkrv fvell
Timeline for d1o4wa_: