Lineage for d1o4ub2 (1o4u B:1-103)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1410866Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1410959Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families) (S)
  5. 1410960Family d.41.2.1: NadC N-terminal domain-like [54676] (4 proteins)
  6. 1410979Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain [54677] (3 species)
  7. 1411008Species Thermotoga maritima [TaxId:2336] [89907] (1 PDB entry)
    TM1645
  8. 1411010Domain d1o4ub2: 1o4u B:1-103 [86627]
    Other proteins in same PDB: d1o4ua1, d1o4ub1
    structural genomics

Details for d1o4ub2

PDB Entry: 1o4u (more details), 2.5 Å

PDB Description: crystal structure of a nicotinate nucleotide pyrophosphorylase (tm1645) from thermotoga maritima at 2.50 a resolution
PDB Compounds: (B:) Type II quinolic acid phosphoribosyltransferase

SCOPe Domain Sequences for d1o4ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4ub2 d.41.2.1 (B:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mekildllmsfvkedegkldlasfplrnttagahlllktenvvasgievsrmflekmgll
skfnvedgeylegtgvigeiegntykllvaertllnvlsvmfs

SCOPe Domain Coordinates for d1o4ub2:

Click to download the PDB-style file with coordinates for d1o4ub2.
(The format of our PDB-style files is described here.)

Timeline for d1o4ub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o4ub1