SCOP 1.67: Domain d1o4ub2: 1o4u B:1-103

Lineage for d1o4ub2 (1o4u B:1-103)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.2: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain [54675] (1 family)

5. Family d.41.2.1: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain [54676] (1 protein)

6. Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain [54677] (3 species)

7. Species Thermotoga maritima [TaxId:243274] [89907] (1 PDB entry)
   TM1645

8. Domain d1o4ub2: 1o4u B:1-103 [86627]
   Other proteins in same PDB: d1o4ua1, d1o4ub1
   structural genomics

Details for d1o4ub2

PDB Entry: 1o4u, 2.5 Å

PDB Description: crystal structure of a nicotinate nucleotide pyrophosphorylase (tm1645) from thermotoga maritima at 2.50 a resolution

SCOP Domain Sequences for d1o4ub2:

Sequence; same for both SEQRES and ATOM records:

>d1o4ub2 d.41.2.1 (B:1-103) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), N-terminal domain {Thermotoga maritima}
mekildllmsfvkedegkldlasfplrnttagahlllktenvvasgievsrmflekmgll
skfnvedgeylegtgvigeiegntykllvaertllnvlsvmfs

Timeline for d1o4ub2:

• d1o4ub2 first appeared in SCOP 1.65
  
• d1o4ub2 appears in SCOP 1.69
  
• d1o4ub2 appears in the current release, SCOPe 2.08