SCOPe 2.05: Domain d1o4ub1: 1o4u B:104-273

Lineage for d1o4ub1 (1o4u B:104-273)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
   incomplete beta/alpha barrel with parallel beta-sheet of 7 strands

5. Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)

6. Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [89507] (1 PDB entry)
   TM1645

8. Domain d1o4ub1: 1o4u B:104-273 [86626]
   Other proteins in same PDB: d1o4ua2, d1o4ub2
   structural genomics

Details for d1o4ub1

PDB Entry: 1o4u, 2.5 Å

PDB Description: crystal structure of a nicotinate nucleotide pyrophosphorylase (tm1645) from thermotoga maritima at 2.50 a resolution

PDB Compounds: (B:) Type II quinolic acid phosphoribosyltransferase

SCOPe Domain Sequences for d1o4ub1:

Sequence, based on SEQRES records:

>d1o4ub1 c.1.17.1 (B:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
vatttrrfaeklkhakiaatrkilpglgvlqkiavvhgggdphrldlsgcvmikdnhlkm
ygsaeravqevrkiipfttkievevenledalraveagadivmldnlspeevkdisrrik
dinpnvivevsggiteenvslydfetvdvisssrltlqevfvdlsleiqr

Sequence, based on observed residues (ATOM records):

>d1o4ub1 c.1.17.1 (B:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
vatttrrfaeklkhakiaatrkilpglgvlqkiavvhgggdgcvmikdnhlkmygsaera
vqevrkiipfttkievevenledalraveagadivmldnlspeevkdisrrikdinpnvi
vevsggiteenvslydfetvdvisssrltlqevfvdlsleiqr

Timeline for d1o4ub1:

• d1o4ub1 first appeared in SCOP 1.65
  
• d1o4ub1 appears in SCOPe 2.04
  
• d1o4ub1 appears in SCOPe 2.06
  
• d1o4ub1 appears in the current release, SCOPe 2.08