Lineage for d1o4ua1 (1o4u A:104-273)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307629Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51690] (1 family) (S)
    imcomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 307630Family c.1.17.1: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51691] (1 protein)
  6. 307631Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)
  7. 307660Species Thermotoga maritima [TaxId:243274] [89507] (1 PDB entry)
    TM1645
  8. 307661Domain d1o4ua1: 1o4u A:104-273 [86624]
    Other proteins in same PDB: d1o4ua2, d1o4ub2

Details for d1o4ua1

PDB Entry: 1o4u (more details), 2.5 Å

PDB Description: crystal structure of a nicotinate nucleotide pyrophosphorylase (tm1645) from thermotoga maritima at 2.50 a resolution

SCOP Domain Sequences for d1o4ua1:

Sequence, based on SEQRES records: (download)

>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima}
vatttrrfaeklkhakiaatrkilpglgvlqkiavvhgggdphrldlsgcvmikdnhlkm
ygsaeravqevrkiipfttkievevenledalraveagadivmldnlspeevkdisrrik
dinpnvivevsggiteenvslydfetvdvisssrltlqevfvdlsleiqr

Sequence, based on observed residues (ATOM records): (download)

>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima}
vatttrrfaeklkhakiaatrkilpglgvlqkiavvhgggdcvmikdnhlkmygsaerav
qevrkiipfttkievevenledalraveagadivmldnlspeevkdisrrikdinpnviv
evsggiteenvslydfetvdvisssrltlqevfvdlsleiqr

SCOP Domain Coordinates for d1o4ua1:

Click to download the PDB-style file with coordinates for d1o4ua1.
(The format of our PDB-style files is described here.)

Timeline for d1o4ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o4ua2