Lineage for d1o4sb1 (1o4s B:1-376)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131052Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 2131198Species Thermotoga maritima [TaxId:2336] [89754] (1 PDB entry)
    TM1255
  8. 2131200Domain d1o4sb1: 1o4s B:1-376 [86621]
    Other proteins in same PDB: d1o4sb2
    structural genomics
    complexed with plp, so4

Details for d1o4sb1

PDB Entry: 1o4s (more details), 1.9 Å

PDB Description: crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (B:) aspartate aminotransferase

SCOPe Domain Sequences for d1o4sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4sb1 c.67.1.1 (B:1-376) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]}
mvsrriseipisktmeldakakalikkgedvinltagepdfptpepvveeavrflqkgev
kytdprgiyelregiakrigerykkdispdqvvvtngakqalfnafmalldpgdevivfs
pvwvsyipqiilaggtvnvvetfmsknfqpsleevegllvgktkavlinspnnptgvvyr
refleglvrlakkrnfyiisdevydslvytdeftsildvsegfdrivyingfskshsmtg
wrvgylissekvatavskiqshttscintvaqyaalkalevdnsymvqtfkerknfvver
lkkmgvkfvepegafylffkvrgddvkfcerlleekkvalvpgsaflkpgfvrlsfatsi
erltealdriedflns

SCOPe Domain Coordinates for d1o4sb1:

Click to download the PDB-style file with coordinates for d1o4sb1.
(The format of our PDB-style files is described here.)

Timeline for d1o4sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o4sb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1o4sa_