Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.1: AAT-like [53384] (17 proteins) |
Protein Aspartate aminotransferase, AAT [53385] (9 species) |
Species Thermotoga maritima [TaxId:2336] [89754] (1 PDB entry) TM1255 |
Domain d1o4sa_: 1o4s A: [86620] Other proteins in same PDB: d1o4sb2 structural genomics complexed with plp, so4 |
PDB Entry: 1o4s (more details), 1.9 Å
SCOPe Domain Sequences for d1o4sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} vsrriseipisktmeldakakalikkgedvinltagepdfptpepvveeavrflqkgevk ytdprgiyelregiakrigerykkdispdqvvvtngakqalfnafmalldpgdevivfsp vwvsyipqiilaggtvnvvetfmsknfqpsleevegllvgktkavlinspnnptgvvyrr efleglvrlakkrnfyiisdevydslvytdeftsildvsegfdrivyingfskshsmtgw rvgylissekvatavskiqshttscintvaqyaalkalevdnsymvqtfkerknfvverl kkmgvkfvepegafylffkvrgddvkfcerlleekkvalvpgsaflkpgfvrlsfatsie rltealdriedflns
Timeline for d1o4sa_: