Lineage for d1o4sa_ (1o4s A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2147073Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2147133Protein Aspartate aminotransferase, AAT [53385] (8 species)
  7. 2147287Species Thermotoga maritima [TaxId:2336] [89754] (1 PDB entry)
    TM1255
  8. 2147288Domain d1o4sa_: 1o4s A: [86620]
    Other proteins in same PDB: d1o4sb2
    structural genomics
    complexed with plp, so4

Details for d1o4sa_

PDB Entry: 1o4s (more details), 1.9 Å

PDB Description: crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (A:) aspartate aminotransferase

SCOPe Domain Sequences for d1o4sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]}
vsrriseipisktmeldakakalikkgedvinltagepdfptpepvveeavrflqkgevk
ytdprgiyelregiakrigerykkdispdqvvvtngakqalfnafmalldpgdevivfsp
vwvsyipqiilaggtvnvvetfmsknfqpsleevegllvgktkavlinspnnptgvvyrr
efleglvrlakkrnfyiisdevydslvytdeftsildvsegfdrivyingfskshsmtgw
rvgylissekvatavskiqshttscintvaqyaalkalevdnsymvqtfkerknfvverl
kkmgvkfvepegafylffkvrgddvkfcerlleekkvalvpgsaflkpgfvrlsfatsie
rltealdriedflns

SCOPe Domain Coordinates for d1o4sa_:

Click to download the PDB-style file with coordinates for d1o4sa_.
(The format of our PDB-style files is described here.)

Timeline for d1o4sa_: