Lineage for d1o3ua1 (1o3u A:1-123)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988152Superfamily a.24.16: Nucleotidyltransferase substrate binding subunit/domain [81593] (5 families) (S)
  5. 1988181Family a.24.16.3: HEPN domain [89022] (2 protein domains)
    automatically mapped to Pfam PF05168
  6. 1988182Protein Hypothetical protein TM0613 [89023] (1 species)
    Family 5 probable bi-partite nucleotidyltransferase subunit; predicted partner is putative catalytic subunit TM0614
  7. 1988183Species Thermotoga maritima [TaxId:2336] [89024] (1 PDB entry)
  8. 1988184Domain d1o3ua1: 1o3u A:1-123 [86615]
    Other proteins in same PDB: d1o3ua2
    structural genomics

Details for d1o3ua1

PDB Entry: 1o3u (more details), 1.75 Å

PDB Description: crystal structure of an hepn domain protein (tm0613) from thermotoga maritima at 1.75 a resolution
PDB Compounds: (A:) conserved hypothetical protein TM0613

SCOPe Domain Sequences for d1o3ua1:

Sequence, based on SEQRES records: (download)

>d1o3ua1 a.24.16.3 (A:1-123) Hypothetical protein TM0613 {Thermotoga maritima [TaxId: 2336]}
mdaakddlehakhdlehgfynwacfssqqaaekavkavfqrmgaqawgysvpdflgelss
rfeipeelmdhaleldkaciptrypdalpsgsprnrysrieaerlvnyaekiirfcedll
sri

Sequence, based on observed residues (ATOM records): (download)

>d1o3ua1 a.24.16.3 (A:1-123) Hypothetical protein TM0613 {Thermotoga maritima [TaxId: 2336]}
mdaakddlehakhdlehgfynwacfssqqaaekavkavfqrmgaqawgysvpdflgelss
rfeipeelmdhaleldkacdalpsgsprnrysrieaerlvnyaekiirfcedllsri

SCOPe Domain Coordinates for d1o3ua1:

Click to download the PDB-style file with coordinates for d1o3ua1.
(The format of our PDB-style files is described here.)

Timeline for d1o3ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o3ua2